Host taxon 10090
Protein NP_081121.1
peptidyl-prolyl cis-trans isomerase-like 1
Mus musculus
Gene Ppil1, UniProt Q9D0W5
>NP_081121.1|Pseudomona aeruginosa PA01|peptidyl-prolyl cis-trans isomerase-like 1
MAAIPPDTWQPPNVYLETSMGVIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKILKAYPSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.21 | -1.20500828902685 | 0.0049 | 32071273 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)