Host taxon 10090
Protein NP_075860.1
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 isoform 1
Mus musculus
Gene Pin1, UniProt Q9QUR7
>NP_075860.1|Pseudomona aeruginosa PA01|peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 isoform 1
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGSTVGGSSKNGQGEPAKVRCSHLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGPFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.82 | 0.821521547519046 | 0.0097 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)