Host taxon 10090
Protein NP_001289006.1
peptidyl-prolyl cis-trans isomerase FKBP1A isoform 1
Mus musculus
Gene Fkbp1a, UniProt P26883
>NP_001289006.1|Pseudomona aeruginosa PA01|peptidyl-prolyl cis-trans isomerase FKBP1A isoform 1
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.3 | 0.30276757629797 | 0.00097 | 32071273 | |
Retrieved 1 of 4 entries in 1.9 ms
(Link to these results)