Bacterial taxon 208964
Protein WP_003101349.1
peptidyl-prolyl cis-trans isomerase
Pseudomona aeruginosa PA01
Gene ppiC2, UniProt Q9HWK5
>WP_003101349.1|Pseudomona aeruginosa PA01|peptidyl-prolyl cis-trans isomerase
MARATARHILVSSEAKCNELKTAIEGGADFAEVAREHSSCPSGRDGGNLGSFGPGQMVREFDQVVFSAPLNVVQGPVKTQFGYHLLEVTSRQD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ -2.23 | -2.23156823703835 | 1.1e-52 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)