Host taxon 10090
Protein NP_033428.1
peptidoglycan recognition protein 1 precursor
Mus musculus
Gene Pglyrp1, UniProt O88593
>NP_033428.1|Pseudomona aeruginosa PA01|peptidoglycan recognition protein 1 precursor
MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.47 | 2.46921917832769 | 1.4e-42 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)