Host taxon 10090
Protein NP_081264.1
parathymosin
Mus musculus
Gene Ptms, UniProt Q9D0J8
>NP_081264.1|Pseudomona aeruginosa PA01|parathymosin
MSEKSVEAAAELSAKDLKEKKDKVEEKAGRKERKKEVVEEEENGAEEEEEETAEDGEDDDEGDEEDEEEEEEDEGPVRKRTAEEEDEADPKRQKTENGASA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.99 | -0.989034784125979 | 4.7e-18 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)