Host taxon 10090
Protein NP_079874.1
pancreatic progenitor cell differentiation and proliferation factor isoform a
Mus musculus
Gene Ppdpf, UniProt Q9CR37
>NP_079874.1|Pseudomona aeruginosa PA01|pancreatic progenitor cell differentiation and proliferation factor isoform a
MAAIPSSGSLVATHDYYRRRLGSSSSSSSGGSAEYPGDAVLQSPGLPKADPGHWWASFFFGKSTLPFMTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVIHSGQTNPRDLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.95 | -1.95261792301469 | 5.6e-14 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)