Host taxon 10090
Protein NP_849270.1
p53 and DNA damage-regulated protein 1
Mus musculus
Gene Pdrg1, UniProt P59048
>NP_849270.1|Pseudomona aeruginosa PA01|p53 and DNA damage-regulated protein 1
MLSPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLRALQKDLSVSEDVMVCFGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFEAQGKPELKGFNLNPLSPDEVKALKVILKG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.87 | -0.866124124317103 | 0.034 | 32071273 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)