Bacterial taxon 208964
Protein WP_003096476.1
P-II family nitrogen regulator
Pseudomona aeruginosa PA01
Gene glnK, UniProt Q9HTR6
>WP_003096476.1|Pseudomona aeruginosa PA01|P-II family nitrogen regulator
MKLVTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIADDQLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTGETDTDAI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ -1.1 | -1.09939237723106 | 3.2e-48 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)