Host taxon 10090
Protein NP_079836.1
oxidoreductase-like domain-containing protein 1 isoform 1
Mus musculus
Gene Oxld1, UniProt Q9CR10
>NP_079836.1|Pseudomona aeruginosa PA01|oxidoreductase-like domain-containing protein 1 isoform 1
MGSPLQTLSRGGRVRAALWCWTQARGLSGRQCPNRVARSLSCSRGFPVRGGRPALGGTMVSVLTESFLQGTQHFSSWDCCQSLHRHRAPVQVTDSRRNLGMDHREEGFQVGTEDDREPKASLPRGNPTGPPCSLPPELEPPTNCCMSGCPNCVWVDYAEALLRLYQDGGEKALAILEEHVTDENLKAFLRMEIRLRMQSGA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.18 | -2.17948088701697 | 0.02 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)