Host taxon 10090
Protein NP_079785.1
oligosaccharyltransferase complex subunit OSTC
Mus musculus
Gene Ostc, UniProt Q78XF5
>NP_079785.1|Pseudomona aeruginosa PA01|oligosaccharyltransferase complex subunit OSTC
METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.58 | -1.57686416697522 | 3.3e-13 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)