Host taxon 10090
Protein NP_796013.1
nutritionally-regulated adipose and cardiac-enriched protein
Mus musculus
Gene A530016L24Rik, UniProt A0A0R4J0P8
>NP_796013.1|Pseudomona aeruginosa PA01|nutritionally-regulated adipose and cardiac-enriched protein
MRSAARVSRSNSHPRTCHPTRENEGTTRGSQPSRTERDGNRKCPPSILRPRRQECGCHGGEPQKTSRHVRFREPLEVAVHYIARKDTTAAIKVPSRPASHGGSPLQPASRSGSLFLWLTLCALLGVVLVLYCGQAKRVTAALEDLLAQLLALILRLWCVVLACWH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.52 | -2.51735952756474 | 0.0084 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)