Host taxon 10090
Protein NP_061227.1
nucleoside diphosphate kinase 6
Mus musculus
Gene Nme6, UniProt O88425
>NP_061227.1|Pseudomona aeruginosa PA01|nucleoside diphosphate kinase 6
MTSILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRTRELQWKLEDCRRFYREHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSIRGSLGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVHYSPEEGIHCAAETGGHKQPNKT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -5.86 | -5.86491976662576 | 8.8e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)