Host taxon 10090
Protein NP_062704.2
nucleoside diphosphate kinase 3 precursor
Mus musculus
Gene Nme3, UniProt Q9WV85
>NP_062704.2|Pseudomona aeruginosa PA01|nucleoside diphosphate kinase 3 precursor
MICLVLTIFANLFPSAYSGVNERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELREKPFYSRLVKYMSSGPVVAMVWQGLDVVHASRALIGATDPGDAMPGTIRGDFCMEVGKNVIHGSDSVESAHREIALWFREAELLCWEDSAGHWLYE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.97 | -1.97104097952488 | 0.0032 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)