Host taxon 10090
Protein NP_851990.2
nucleoplasmin-2
Mus musculus
Gene Npm2, UniProt Q80W85
>NP_851990.2|Pseudomona aeruginosa PA01|nucleoplasmin-2
MSRHSTSSVTETTAKNMLWGSELNQEKQTCTFRGQGEKKDSCKLLLSTICLGEKAKEEVNRVEVLSQEGRKPPITIATLKASVLPMVTVSGIELSPPVTFRLRTGSGPVFLSGLECYETSDLTWEDDEEEEEEEEEEDEDEDADISLEEIPVKQVKRVAPQKQMSIAKKKKVEKEEDETVVRPSPQDKSPWKKEKSTPRAKKPVTKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.3 | 1.30234579051205 | 0.013 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)