Host taxon 10090
Protein NP_848720.1
nucleolar protein 16
Mus musculus
Gene Nop16, UniProt Q9CPT5
>NP_848720.1|Pseudomona aeruginosa PA01|nucleolar protein 16
MPKAKGKTRRQKFGYNVNRKRLNRNARRKAAPRIECSHIRHAWDHTKSVRQNLAEMGLAMDPNKAVPLRKKKVKAMEVDTEERPRDLVRKPYVVNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRNKINVYKRFYPTEWQAFIDSLQSKKMEVD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.01 | 1.00764908279881 | 0.0044 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)