Host taxon 10090
Protein NP_001139276.1
nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 isoform 2
Mus musculus
Gene Nucks1, UniProt Q80XU3
>NP_001139276.1|Pseudomona aeruginosa PA01|nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 isoform 2
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPAKKIRSSPREAKNKRRSGKNSQEDSEDSEEKDVKTKKDDSHSAEDSEDEKDDHKNVRQQRQAASKAASKQREMLLEDVGSEEEPEEDDEAPFQENSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKAKVGRPTASKKSKEKTPSPKEEDEEAESPPEKKSGDEGSEDEASSGED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.49 | 0.492868996361464 | 9.1e-7 | 32071273 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)