Host taxon 10090
Protein NP_080808.1
nuclear transport factor 2
Mus musculus
Gene Nutf2, UniProt P61971
>NP_080808.1|Pseudomona aeruginosa PA01|nuclear transport factor 2
MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.18 | -1.18045133271001 | 1.5e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)