Host taxon 10090
Protein NP_038722.3
nuclear transition protein 2
Mus musculus
Gene Tnp2, UniProt P11378
>NP_038722.3|Pseudomona aeruginosa PA01|nuclear transition protein 2
MDTKMQSLPTTHPHPHSSSRPQSHTSNQCNQCTCSHHCRSCSQAGHAGSSSSPSPGPPMKHPKPSVHSRHSPARPSHRGSCPKNRKTFEGKVSKRKAVRRRKRTHRAKRRSSGRRYK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.01 | 5.01466298074072 | 0.019 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)