Host taxon 10090
Protein NP_001136119.1
nuclear envelope integral membrane protein 2 precursor
Mus musculus
Gene Nemp2, UniProt Q8CB65
>NP_001136119.1|Pseudomona aeruginosa PA01|nuclear envelope integral membrane protein 2 precursor
MLPRLWWLVLWLQPLATLPASAVHDEEAAMSVPRCKSLKETDLIKTSVSDCYCYNQHSQIQWTYMWSTVQVTVTSPGLLNIVYITGSHNCQHTESILSFIKCVTHNFWAPEEAEEITIVFSPYGETVCFSVKPVGRLLPYIVSVSRNIVDFKLFLVFVTGIFLFLYAKTLSQSPVFYYSSGTVLGILMTLVFVLLMAKKHIPKYSTFGALMIGCWFASVYVLCQLMEDLKWLWYGNRMYILGYVVVVGLCSFAACYSHGPLADEGSRDLLMWTLRLFSLALVYTGVAAPQFAYAVLIVLLFSWSLHYLLRAFSYLRWKMRPWFTAEPQVARYLTDDEYREQAEAATARALEELRQACCRPDFPSWLAVSRLQAPKKFAEFVLGASHLSPEEVSTHEKQYGLGGAFLEEQLFSLQTDSLPAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.14 | -1.13839538317489 | 0.0015 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)