Host taxon 10090
Protein NP_001079015.1
novel KRAB box and zinc finger, C2H2 type domain containing protein
Mus musculus
Gene Gm14393, UniProt A2ARW5
>NP_001079015.1|Pseudomona aeruginosa PA01|novel KRAB box and zinc finger, C2H2 type domain containing protein
MDLVTYDDVHVNFTQEEWALLDPSQKSLYKGVMLETYRNLTAIGYIWEEHTIEDHFQTSRSHGRRERSCTAEQPSEFIQCGKAFAYESCSQRHQIKHNGEKHHDCNQCGKAFKRRSDLQIHKRTHTGEKPYECNQCGKAFARSDDLQKHKRTHTGEKPYECKQCGKAFAGSSGLQCHKRSHTGETPY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.06 | -3.06270885243622 | 1.3e-13 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)