Host taxon 10090
Protein NP_080256.2
notch-regulated ankyrin repeat-containing protein
Mus musculus
Gene Nrarp, UniProt Q91ZA8
>NP_080256.2|Pseudomona aeruginosa PA01|notch-regulated ankyrin repeat-containing protein
MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.49 | -2.48851979760311 | 8.9e-24 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)