Host taxon 10090
Protein NP_444341.1
non-secretory ribonuclease precursor
Mus musculus
Gene Ear6, UniProt Q923L7
>NP_444341.1|Pseudomona aeruginosa PA01|non-secretory ribonuclease precursor
MGPKLLESQLCLLLMLGLVLMLASCQKPTASQWFATQHITYKANLQCNVEMQAINMHRPRCKGLNTFLHTSFINVVGVCSNPSGLCSDKISQNCHNSSSRVPITVCNLTTPRRNYTQCRYQTKGSVEYYTVACEPRVAWDCPIYPVVPVHLDGTF
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.59 | 5.59008962864354 | 7.1e-8 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)