Host taxon 10090
Protein NP_038638.1
ninjurin-1
Mus musculus
Gene Ninj1, UniProt O70131
>NP_038638.1|Pseudomona aeruginosa PA01|ninjurin-1
MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.63 | 2.62852513977977 | 3.4e-32 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)