Host taxon 10090
Protein NP_001034127.1
NHL-repeat-containing protein 4
Mus musculus
Gene Nhlrc4, UniProt Q3UP44
>NP_001034127.1|Pseudomona aeruginosa PA01|NHL-repeat-containing protein 4
MLGPTWEPLAPTSMLGLEGPCWVGPGPDGGFAVSEEFGDVQLFGSAHQPLGSLGTLTGHNFGHPAGVCSDAEGSIIVADEQRHQVTLFPRVGPPICLQLEGLKRPLGMACAPQGQLVVADAGDNCIKLYQYLGEMA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.84 | -3.8408782205783 | 0.0058 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)