Host taxon 10090
Protein NP_001103458.1
neuronal regeneration-related protein
Mus musculus
Gene Nrep, UniProt Q07475
>NP_001103458.1|Pseudomona aeruginosa PA01|neuronal regeneration-related protein
MVYYPELLVWVSQEPFAYKEMEGGLIKGRLPVPKEVNRKKMEETGAASLTPPGSREFTSPATSYLHPF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.51 | -1.51483007609073 | 1.5e-20 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)