Host taxon 10090
Protein NP_705757.1
neuritin isoform 1 precursor
Mus musculus
Gene Nrn1, UniProt Q8CFV4
>NP_705757.1|Pseudomona aeruginosa PA01|neuritin isoform 1 precursor
MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSSNGAAGSLLPALSVLLVSLSAALATWFSF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.79 | -2.7924239585765 | 1.1e-16 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)