Host taxon 10090
Protein NP_080730.1
NEDD8-conjugating enzyme UBE2F
Mus musculus
Gene Ube2f, UniProt Q9CY34
>NP_080730.1|Pseudomona aeruginosa PA01|NEDD8-conjugating enzyme UBE2F
MLTLASKLKRDDGLKGSRTSASTSDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRDKVDEYIKRYAR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.76 | 1.76244426745367 | 1.2e-26 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)