Bacterial taxon 208964
Protein WP_003090467.1
NADH-quinone oxidoreductase subunit NuoI
Pseudomona aeruginosa PA01
Gene nuoI, UniProt Q9I0J4
>WP_003090467.1|Pseudomona aeruginosa PA01|NADH-quinone oxidoreductase subunit NuoI
MIKEIINVVHGTFTQLRSLVMIFGHAFRKRDTLQYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETEDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFEMGEFKRQDLVYEKHDLLISGPGKNPDYNYYRVAGMAIAGKPKGAAQNEAEPINVKSLLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.49 | 0.491917885556956 | 2.3e-6 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)