Host taxon 10090
Protein NP_001025445.1
NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
Mus musculus
Gene Ndufs5, UniProt Q99LY9
>NP_001025445.1|Pseudomona aeruginosa PA01|NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
MPFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTRAKKECKIEFDDFEECLLRYKTMRRMHDIKKQREKLMKEGKYTPPPHHSGREEPRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.88 | -0.87950925914822 | 0.025 | 32071273 | |
Retrieved 1 of 1 entries in 6.8 ms
(Link to these results)