Host taxon 10090
Protein NP_001265344.1
NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial isoform 2
Mus musculus
Gene Ndufv2, UniProt Q9D6J6
>NP_001265344.1|Pseudomona aeruginosa PA01|NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial isoform 2
MNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.54 | -0.541297951655932 | 0.033 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)