Host taxon 10090
Protein NP_080886.1
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
Mus musculus
Gene Ndufb4, UniProt Q9CQC7
>NP_080886.1|Pseudomona aeruginosa PA01|NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
MSGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHIEDPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGKLDRKFNISY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.86 | 1.85878792017434 | 0.039 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)