Host taxon 10090
Protein NP_079873.1
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
Mus musculus
Gene Ndufb3, UniProt Q9CQZ6
>NP_079873.1|Pseudomona aeruginosa PA01|NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
MAAGHGHEHGHEHGHGHGKMELPDYRQWKIEGTPLETVQKKLAARGLRDPWARNEAWRYMGGFAGNITFPSVILKGFKWGFAAFVVALGAEYFLDSQNGDKKHH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.15 | -1.14598230506881 | 0.0029 | 32071273 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)