Host taxon 10090
Protein NP_080979.1
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Mus musculus
Gene Ndufa8, UniProt Q9DCJ5
>NP_080979.1|Pseudomona aeruginosa PA01|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
MPGIVELPTLEELKVEEVKVSSAVLKAAAHHYGAQCDKTNKEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLDYSNMQLFRHCRQQQAKFDQCVLDKLGWVRPDLGQLSKVTKVKTDRPLPENPYHSRARPEPNPVIEGDLKPAKHGTRFFFWTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.77 | -0.773311238060449 | 0.0014 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)