Host taxon 10090
Protein NP_001135437.1
N-alpha-acetyltransferase 20 isoform 1
Mus musculus
Gene Naa20, UniProt P61600
>NP_001135437.1|Pseudomona aeruginosa PA01|N-alpha-acetyltransferase 20 isoform 1
MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.98 | 0.984024739859384 | 3.8e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1.4 ms
(Link to these results)