Host taxon 10090
Protein NP_063923.1
N-alpha-acetyltransferase 10 isoform 1
Mus musculus
Gene Naa10, UniProt Q9QY36
>NP_063923.1|Pseudomona aeruginosa PA01|N-alpha-acetyltransferase 10 isoform 1
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGKHMVLAALENKAENKGNVLLSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.88 | -1.87673197881169 | 6.5e-5 | 32071273 | |
Retrieved 1 of 4 entries in 1.5 ms
(Link to these results)