Host taxon 10090
Protein NP_001157159.1
N-acylethanolamine-hydrolyzing acid amidase isoform 2 precursor
Mus musculus
Gene Naaa, UniProt Q9D7V9
>NP_001157159.1|Pseudomona aeruginosa PA01|N-acylethanolamine-hydrolyzing acid amidase isoform 2 precursor
MGTLATRAACHGAHLALALLLLLSLSGPWLSAVVPGTPPLFNVSLDAAPEQRWLPMLRHYDPDFLRTAVAQVIGVPQWVLGMVGEIVSKVESFLPQPFTDEIRSICDSLNLSLADGILVNLAYEASAFCTSIVAQDSQGHIYHGRNLDYPFGKILRKLTANVQFIKNGQIAFTGTTFVGYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWLIRKTLSESESFEAAVYTLAKTPLIADVYYIVGGTSPKEGVVITRDRGGPADIWPLDPLNGEWFRVETNYDHWKPAPKVDDRRTPAIKALNATGQAHLNLETLFQVLSLFPVYNNYTIYTTVMSAAEPDKYLTMIRNPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.75 | -0.754875610167412 | 1.8e-5 | 32071273 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)