Host taxon 10090
Protein NP_032124.1
myotrophin
Mus musculus
Gene Mtpn, UniProt P62774
>NP_032124.1|Pseudomona aeruginosa PA01|myotrophin
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.36 | 0.358227424867909 | 4.5e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)