Host taxon 10090
Protein NP_742116.1
myosin regulatory light polypeptide 9
Mus musculus
Gene Myl9, UniProt Q9CQ19
>NP_742116.1|Pseudomona aeruginosa PA01|myosin regulatory light polypeptide 9
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.82 | -0.822994119450891 | 7.7e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)