Host taxon 10090
Protein NP_080340.2
myosin light chain, regulatory B-like isoform 1
Mus musculus
Gene Myl12a, UniProt Q6ZWQ9
>NP_080340.2|Pseudomona aeruginosa PA01|myosin light chain, regulatory B-like isoform 1
MSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASMGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEAIGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.37 | 0.373613505780035 | 2.3e-8 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)