Host taxon 10090
Protein NP_001153707.1
myelin-associated neurite-outgrowth inhibitor isoform 1
Mus musculus
Gene Fam168b, UniProt Q80XQ8
>NP_001153707.1|Pseudomona aeruginosa PA01|myelin-associated neurite-outgrowth inhibitor isoform 1
MNPVYSPGSSGVPYANAKGIGYPAGFPVGYAAAPAYSPNMYPGANPTFQTVLEIEPRVLHMLGYTPGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPRGSGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.59 | 0.587007815209234 | 1.5e-16 | 32071273 | |
Retrieved 1 of 3 entries in 0.4 ms
(Link to these results)