Host taxon 10090
Protein NP_001276491.1
mpv17-like protein isoform 3
Mus musculus
Gene Mpv17l, UniProt Q99MS3
>NP_001276491.1|Pseudomona aeruginosa PA01|mpv17-like protein isoform 3
MRYPPGMSVLQGKDDIFLDLKQKFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQSGDGTLQSIFIFLRRKEASDKSPEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.37 | -1.36903503174551 | 0.0009 | 32071273 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)