Host taxon 10090
Protein NP_001277443.1
motile sperm domain-containing protein 1 isoform 2
Mus musculus
Gene Mospd1, UniProt Q8VEL0
>NP_001277443.1|Pseudomona aeruginosa PA01|motile sperm domain-containing protein 1 isoform 2
MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.8 | 1.79873725942323 | 1.3e-15 | 32071273 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)