Host taxon 10090
Protein NP_932776.1
MORN repeat-containing protein 4
Mus musculus
Gene Morn4, UniProt Q6PGF2
>NP_932776.1|Pseudomona aeruginosa PA01|MORN repeat-containing protein 4
MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLVFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFSQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAVVQRAQSASKSARNLTA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.71 | -1.70689790273833 | 0.018 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)