Host taxon 10090
Protein NP_001334385.1
MORN repeat-containing protein 3 isoform 2
Mus musculus
Gene Morn3, UniProt Q8C5T4
>NP_001334385.1|Pseudomona aeruginosa PA01|MORN repeat-containing protein 3 isoform 2
MPVTKCPRKVEPPWKGWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLSGDSRPRWCAEGSVG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.45 | 1.45355392130286 | 0.03 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)