Bacterial taxon 208964
Protein WP_003093023.1
molybdenum cofactor biosynthesis protein B
Pseudomona aeruginosa PA01
Gene moaB1, UniProt Q9HX98
>WP_003093023.1|Pseudomona aeruginosa PA01|molybdenum cofactor biosynthesis protein B
MSHLATSTFQPLNIAILTVSDTRTLETDTSGQTLADALLAAGHRLHQRSLKTDDIYQIRAVVSAWIADPEVQVGLITGGTGFTARDNTPQAVGPLFERDVEGFGELFRQVSQREIGTSTIQSRALAGLSNGTLVCCLPGSPGACRTAWNEILLAQLDSRTRPCNFVPHLKTPPAVAPVAGCGCRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.53 | 1.53241690192682 | 3.8e-22 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)