Bacterial taxon 208964
Protein WP_003088068.1
molybdate ABC transporter permease subunit
Pseudomona aeruginosa PA01
Gene modB, UniProt Q9I2N3
>WP_003088068.1|Pseudomona aeruginosa PA01|molybdate ABC transporter permease subunit
MALPLDSTDLAAIWLTIELASLTTLLLLLIGTPIAWWLARTRSWLKGPIGAVVALPLVLPPTVIGFYLLVSMGPNGFIGQLTQSLGLGTLPFTFAGLVVGSVFYSLPFVVQPLQNAFEAIGEKPLEAAATLRASPVDRFFSVVLPLARPGFVTAAILGFAHTVGEFGVVLMIGGNIPEKTRVVSVQIFDHVEAMEYAQAHWLAGGMVAFSFVVLLALYSGRRRRPGWA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.97 | 0.967126765174838 | 8.7e-5 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)