Host taxon 10090
Protein NP_835162.1
MOB kinase activator 3B
Mus musculus
Gene Mob3b, UniProt Q8VE04
>NP_835162.1|Pseudomona aeruginosa PA01|MOB kinase activator 3B
MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLRAAVQLPNGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEDIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTTRMCH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.02 | -1.02277090408739 | 4.4e-10 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)