Host taxon 10090
Protein NP_001239313.1
mitochondrial thiamine pyrophosphate carrier isoform 1
Mus musculus
Gene Slc25a19, UniProt Q9DAM5
>NP_001239313.1|Pseudomona aeruginosa PA01|mitochondrial thiamine pyrophosphate carrier isoform 1
MVGYDAKADVRSNSKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYHGIFQAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLYQANLYQTHQFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQTGNLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCNLFHCIRREDR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.56 | -1.56192462144083 | 0.0047 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)