Host taxon 10090
Protein NP_061289.1
mitochondrial pyruvate carrier 1 isoform 1
Mus musculus
Gene Mpc1, UniProt P63030
>NP_061289.1|Pseudomona aeruginosa PA01|mitochondrial pyruvate carrier 1 isoform 1
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.71 | 0.705309641743633 | 0.009 | 32071273 | |
Retrieved 1 of 3 entries in 0.6 ms
(Link to these results)